PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10006864m
Common NameCARUB_v10006864mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 346aa    MW: 38062.6 Da    PI: 6.0417
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10006864mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.4e-151562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEd++l  ++++ G g+W++ ++  g++R++k+c++rw +yl
  Carubv10006864m 15 KGPWMQEEDDKLTAYINENGYGNWRSLPKLAGLNRCGKSCRLRWMNYL 62
                     79********************************************97 PP

2Myb_DNA-binding55.21.6e-1768113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE+  +++++++lG++ W++Ia +++ gRt++++k++w++++
  Carubv10006864m  68 RGKFSDEEESTIIRLHALLGNK-WSKIAGHLP-GRTDNEIKNYWNTHM 113
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0761062IPR017930Myb domain
SuperFamilySSF466893.74E-2912109IPR009057Homeodomain-like
SMARTSM007179.8E-111464IPR001005SANT/Myb domain
PfamPF002491.7E-131562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-221669IPR009057Homeodomain-like
CDDcd001675.59E-91762No hitNo description
PROSITE profilePS5129427.33363117IPR017930Myb domain
SMARTSM007174.6E-1667115IPR001005SANT/Myb domain
PfamPF002495.3E-1668112IPR001005SANT/Myb domain
CDDcd001671.61E-1270113No hitNo description
Gene3DG3DSA:1.10.10.603.1E-2770117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGRSPCCDQD KGVKKGPWMQ EEDDKLTAYI NENGYGNWRS LPKLAGLNRC GKSCRLRWMN  60
YLRPDIRRGK FSDEEESTII RLHALLGNKW SKIAGHLPGR TDNEIKNYWN THMRKKLLQM  120
GIDPMTHEPR TNELSPILDV SQMLVAAINN GQFGNNNLFN NSTTALEDLL KLQLIHKMLQ  180
IISPKAVPNI NSFNTATSVN PKPDTTVPHV FINQSGITPE AATSDLISSY DNVWDGIEDN  240
QLPGLVTVSQ DGLNASKPGT STTTEGNDQT GAGYYPDQLH KIPSSGLVSV SPVTSGLNHP  300
GTAQHSSAGS DVLEDWGKFL DDETSDSCWK SFLDLTSPTS SPLPW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-26151174105MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-26151174105C-Myb DNA-Binding Domain
1msf_C3e-26151174105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00438DAPTransfer from AT4G17785Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759890.0AF175989.1 Arabidopsis thaliana putative transcription factor (MYB39) mRNA, complete cds.
GenBankAK1187280.0AK118728.1 Arabidopsis thaliana At4g17780 mRNA for putative MYB transcription factor, complete cds, clone: RAFL21-07-A19.
GenBankAY5502970.0AY550297.1 Arabidopsis thaliana MYB transcription factor (At4g17785) mRNA, complete cds.
GenBankBT0056420.0BT005642.1 Arabidopsis thaliana clone U51012 putative MYB transcription factor (At4g17785) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285445.10.0hypothetical protein CARUB_v10006864mg
SwissprotQ8GWP00.0MYB39_ARATH; Transcription factor MYB39
TrEMBLR0H4840.0R0H484_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.7__2528__AT4G17785.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122431730
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17785.10.0myb domain protein 39